The two weeks (Oct.23 –Nov. 6 at 10AM) has taken into account the likely outrage of Blackboard and the Nov. 6 deadline will not be extended. Correct answers will be posted on Nov. 6 after the deadline.Total 20 points (2 points per question)1. Use Pubmed, search to find out how many published papers about the Arabidopsis gene TSO1a. 7b. 9c. 32d. 122. Use Protein database to search for TSO1 protein sequence.Arabidopsis TSO1 protein contains how many amino acids? a. 887b. 1007c. 245d. 6953. Dr. Liu did a blastp search using TSO1 protein and found following alignment between TSO1 (Query) and another protein (Sbjct). The % positive between these two proteins are:Query 1 MDKSQKNPTSQIGTSTPKSKFEDSPVFNYISNLSPIESVKSISTAQTFSSLSFTSPPPVF 60MD ++N QI + P SKFEDSPVFN+I++LSPI+ VKS AQTF+SLSF S P +F Sbjct 1 MDTPERN---QI--AAPISKFEDSPVFNFINSLSPIKPVKSAHIAQTFNSLSFVSLPSIF 55 Query 61 TSPHVISHRESRFFRCHNSVDRSK-HLESLDGSAV 94 TSPHV SH+ESRF R HN D SK S++G+ V Sbjct 56 TSPHVSSHKESRFLRRHNFSDPSKPEFSSVNGNKV 90a. 58% b. 72%c. 6%e. 26%4. An example of a protein domain in TSO1 isa. Homeoboxb. CXCc. MADS d. GEF5. When comparing similarities between two sequences, the E-value needs to be _____ in order to show that the homology is valid.(a) High(b)Low6. When comparing similarities between two sequences, the Score needs to be ______ in order to show that the homology is high.(a) High(b) Low7. . Search the "Structure" database with "Drosophila AND Homeodomain" as a query. How many different homeodomain structure entries did you obtain?(a) 100(b) 32(c) 478. Search for structure of 3A01 and subsequently look into the 3D structure using the Cn3D program. The Cn3D program shows two homeodomain proteins (Blue and Purple) bind to brown and green strands. What are the brown and green strands?(a) RNA(b) Alpha helixes of a third protein(c) Double stranded DNA9. In the structure above, each homeodomain consists of (a) Two beta-sheets(b) Three beta-sheets© two alpha-helixes(c) Three alpha-helixes10. (Bonus-anything answer is correct) Which genetic disease do you found most interesting from the presentations in class?(Blank area for filling in
View Full Document
Unlocking...