Unformatted text preview:

CMSC423 Project 1 Handed out 10 2 2008 Due 10 28 2008 For this project you will have to create a program that takes as input a sequence and searches for all good alignments of this sequence inside a database using the SmithWaterman dynamic programming algorithm described in class Inputs one query sequence in FASTA format multiple sequence database in FASTA format similarity matrix see format on syllabus page minimum identity gap opening creation and extension penalty i e using affine gaps Outputs precise local alignment for all hits over identity Sample inputs See syllabus page http www cbcb umd edu confcour CMSC423 syllabus shtml Output format See syllabus page http www cbcb umd edu confcour CMSC423 syllabus shtml gi 90423415 ref YP 531785 1 Gene info cytochrome c class I Rhodopseudomonas palustris BisB18 Score 184 Identities 49 152 32 Gaps 6 152 3 Query 23 Text 3 LPKTRTKALLTALTLAAAAAAAPALADVEFRHAL DDSALDLSPIKGEEITDAVKSFR P A A AL FRH D S G T AV F MPSFNRSIAISATLAVGLLAPVVALGQEVFRHTVTGEDLKIMETSQPSGRD TEAVRNFL 79 61 Note The output must include for each database sequence matching the query the header of the database sequence aggregate information Smith Waterman score score number of identities and percentage w r t length aligned range within query sequence and and of gaps the full alignment information including the identifiers for the aligned sequences coordinates along these sequences gaps within the sequences Furthermore identical amino acids are highlighted by repeating the identical letter in between the aligned sequences Input format Your program must accept all parameters from the command line e g myprogram m BLOSUM matrix d sequence database i sequence input Submission Use the submit program this project should be submitted as assignment 3 submit 2008 fall cmsc 423 0101 3 submission file Grading We will grade all aspects of the code including how pretty it looks Specifically pay attention to the following aspects 1 Please make sure that your code works as advertised in the README file you provided If your code doesn t work as indicated in the README file you will automatically lose 50 of the grade for this assignment 2 Please provide copious comments and format your code so that it is easy to read Part of your grade will be based on the formatting of the code 3 Fastest programs get additional credit a 20 points for fastest b 12 points for second fastest c 5 points for third fastest 4 If your code does not implement affine gap penalties the maximum score you will receive is 75 and your program will not be part of the speed competition Please contact me and Mohammad as soon as possible if you have any questions regarding this assignment or if you get stuck and might not be able to complete the assignment on time Once the assignment is due I will no longer accept any excuses Important Please copy all email to both myself and Mohammad if you want a quick reply Good Luck


View Full Document

UMD CMSC 423 - Project 1

Documents in this Course
Midterm

Midterm

8 pages

Lecture 7

Lecture 7

15 pages

Load more
Loading Unlocking...
Login

Join to view Project 1 and access 3M+ class-specific study document.

or
We will never post anything without your permission.
Don't have an account?
Sign Up

Join to view Project 1 and access 3M+ class-specific study document.

or

By creating an account you agree to our Privacy Policy and Terms Of Use

Already a member?